PDB entry 5oby

View 5oby on RCSB PDB site
Description: Mycoplasma genitalium DnaK-NBD in complex with AMP-PNP
Class: chaperone
Keywords: Complex, co-factor, ATP hydrolysis, CHAPERONE
Deposited on 2017-06-29, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein dnaK
    Species: Mycoplasma genitalium G37 [TaxId:243273]
    Gene: dnaK, hsp70, MG305
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47547 (Start-365)
      • expression tag (366-367)
    Domains in SCOPe 2.07: d5obya1, d5obya2, d5obya3
  • Heterogens: MG, ANP, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5obyA (A:)
    msadngliigidlgttnscvsvmeggrpvvlenpegkrttpsivsyknneiivgdaakrq
    mvtnpntivsikrlmgtsnkvkvqnadgttkelspeqvsaqilsylkdfaekkigkkisr
    avitvpayfndaernatktagkiaglnveriineptaaalaygidkasremkvlvydlgg
    gtfdvslldiaegtfevlatagdnrlggddwdnkiieyisayiakehqglnlskdkmamq
    rlkeaaerakielsaqletiislpfltvtqkgpvnvelkltrakfeeltkpllertrnpi
    sdvikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsinpdevvaigaaiqg
    gvlrgdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5obyA (A:)
    dngliigidlgttnscvsvmeggrpvvlenpegkrttpsivsyknneiivgdaakrqmvt
    npntivsikrlmgtsnkvkvqnadgttkelspeqvsaqilsylkdfaekkigkkisravi
    tvpayfndaernatktagkiaglnveriineptaaalaygidkasremkvlvydlgggtf
    dvslldiaegtfevlatagdnrlggddwdnkiieyisayiakehqglnlskdkmamqrlk
    eaaerakielsaqletiislpfltvtqkgpvnvelkltrakfeeltkpllertrnpisdv
    ikeakikpeeineillvggstrmpavqklvesmvpgkkpnrsinpdevvaigaaiqggvl
    rgdle