PDB entry 5obn

View 5obn on RCSB PDB site
Description: NMR solution structure of U11/U12 65K protein's C-terminal RRM domain (381-516)
Class: splicing
Keywords: Minor spliceosome, RNA binding, SPLICING
Deposited on 2017-06-28, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 40
    Species: Homo sapiens [TaxId:9606]
    Gene: RNPC3, KIAA1839, RBM40, RNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5obna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5obnA (A:)
    sdempsecisrrelekgrisreemetlsvfrsyepgepncriyvknlakhvqekdlkyif
    gryvdfssetqrimfdirlmkegrmkgqafiglpnekaaakalkeangyvlfgkpmvvqf
    arsarpkqdpkegkrk