PDB entry 5o94

View 5o94 on RCSB PDB site
Description: X-ray structure of a zinc binding GB1 mutant
Class: metal binding protein
Keywords: immunoglobulin bindi, metal binding protein
Deposited on 2017-06-15, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metal binding GB1
    Species: Streptococcus sp. [TaxId:1306]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5O94 (0-55)
    Domains in SCOPe 2.07: d5o94a_
  • Heterogens: ZN, MPD, NA, SO4, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5o94A (A:)
    mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte