PDB entry 5o6t

View 5o6t on RCSB PDB site
Description: BIRC4 RING in complex with dimeric ubiquitin variant
Class: ligase
Keywords: E3 ring ligase, ubiquitin variant, LIGASE
Deposited on 2017-06-07, released 2017-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: XIAP, API3, BIRC4, IAP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170 (2-65)
• Chain 'B':
  Compound: E3 ubiquitin-protein ligase XIAP
  Species: Homo sapiens [TaxId:9606]
  Gene: XIAP, API3, BIRC4, IAP3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P98170 (Start-65)
• Chain 'C':
  Compound: Polyubiquitin-B
  Species: Homo sapiens [TaxId:9606]
  Gene: UBB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG47 (Start-75)
    • conflict (1)
    • conflict (5)
    • conflict (7)
    • conflict (9-12)
    • conflict (15)
    • conflict (45)
    • conflict (47)
    • conflict (63)
    • conflict (65)
    • conflict (69)
    • conflict (72-75)
  Domains in SCOPe 2.06: d5o6tc_
• Chain 'D':
  Compound: Polyubiquitin-B
  Species: Homo sapiens [TaxId:9606]
  Gene: UBB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG47
    • conflict (1)
    • conflict (5)
    • conflict (7)
    • conflict (9-12)
    • conflict (15)
    • conflict (45)
    • conflict (47)
    • conflict (63)
    • conflict (65)
    • conflict (69)
    • conflict (72-74)
  Domains in SCOPe 2.06: d5o6td_
• Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >5o6tC (C:)
  gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
  yninkkstlllvvkfhrvas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5o6tC (C:)
  smqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdy
  ninkkstlllvvkfh
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >5o6tD (D:)
  gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
  yninkkstlllvvkfhrvas
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5o6tD (D:)
  smqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdy
  ninkkstlllvvkf