PDB entry 5o6t

View 5o6t on RCSB PDB site
Description: BIRC4 RING in complex with dimeric ubiquitin variant
Class: ligase
Keywords: E3 ring ligase, ubiquitin variant, LIGASE
Deposited on 2017-06-07, released 2017-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (Start-75)
      • conflict (1)
      • conflict (5)
      • conflict (7)
      • conflict (9-12)
      • conflict (15)
      • conflict (45)
      • conflict (47)
      • conflict (63)
      • conflict (65)
      • conflict (69)
      • conflict (72-75)
    Domains in SCOPe 2.07: d5o6tc_
  • Chain 'D':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47
      • conflict (1)
      • conflict (5)
      • conflict (7)
      • conflict (9-12)
      • conflict (15)
      • conflict (45)
      • conflict (47)
      • conflict (63)
      • conflict (65)
      • conflict (69)
      • conflict (72-74)
    Domains in SCOPe 2.07: d5o6td_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o6tC (C:)
    gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
    yninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6tC (C:)
    smqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdy
    ninkkstlllvvkfh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o6tD (D:)
    gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
    yninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6tD (D:)
    smqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdy
    ninkkstlllvvkf