PDB entry 5o6s

View 5o6s on RCSB PDB site
Description: UbV.B4R, a dimeric ubiquitin variant binding to BIRC4 RING
Class: protein binding
Keywords: Ubiquitin variant, PROTEIN BINDING
Deposited on 2017-06-07, released 2017-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 5O6S
    Domains in SCOPe 2.06: d5o6sa1, d5o6sa2
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 5O6S
    Domains in SCOPe 2.06: d5o6sb1, d5o6sb2
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 5O6S
    Domains in SCOPe 2.06: d5o6sc1, d5o6sc2
  • Chain 'D':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 5O6S
    Domains in SCOPe 2.06: d5o6sd1, d5o6sd2
  • Chain 'E':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 5O6S
    Domains in SCOPe 2.06: d5o6se1, d5o6se2
  • Chain 'F':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • PDB 5O6S
    Domains in SCOPe 2.06: d5o6sf1, d5o6sf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o6sA (A:)
    gsggsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrt
    lsdyninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6sA (A:)
    gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
    yninkkstlllvvkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o6sB (B:)
    gsggsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrt
    lsdyninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6sB (B:)
    gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
    yninkkstlllvvkfh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o6sC (C:)
    gsggsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrt
    lsdyninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6sC (C:)
    smqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdy
    ninkkstlllvvkfh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o6sD (D:)
    gsggsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrt
    lsdyninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6sD (D:)
    gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
    yninkkstlllvvkf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5o6sE (E:)
    gsggsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrt
    lsdyninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6sE (E:)
    gsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsd
    yninkkstlllvvkf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5o6sF (F:)
    gsggsmqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrt
    lsdyninkkstlllvvkfhrvas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6sF (F:)
    smqilvttisaetirlevepsdtienvkakiqdkegippdqqrlffegkqledgrtlsdy
    ninkkstlllvvkf