PDB entry 5o6p

View 5o6p on RCSB PDB site
Description: Structure of beta-phosphoglucomutase D10N mutant in complex with glucose-1,6-bisphosphate
Class: isomerase
Keywords: phosphoryl transfer, catalysis, near attack complex, isomerase
Deposited on 2017-06-07, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: pgmB, LL0429, L0001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447
      • engineered mutation (9)
      • conflict (124)
      • conflict (205)
    Domains in SCOPe 2.07: d5o6pa_
  • Heterogens: B16, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o6pA (A:)
    mfkavlfdlngvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o6pA (A:)
    fkavlfdlngvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildlad
    kkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngpf
    llermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikds
    galpigvgrivivpdtshytleflkevwl