PDB entry 5o4k

View 5o4k on RCSB PDB site
Description: Crystal structure of P450 CYP121 in complex with compound 6b.
Class: oxidoreductase
Keywords: Cytochrome P450 Redox Inhibitor, oxidoreductase
Deposited on 2017-05-29, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mycocyclosin synthase
    Species: Mycobacterium tuberculosis CDC1551 [TaxId:83331]
    Gene: cyp121, MT2336
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5o4ka_
  • Heterogens: SO4, HEM, 9KE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o4kA (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4kA (A:)
    atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
    ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
    nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
    drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
    ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
    elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
    lkkmpgvdlavpidqlvwrtrfqrriperlpvlw