PDB entry 5o4e

View 5o4e on RCSB PDB site
Description: Crystal structure of VEGF in complex with heterodimeric Fcab JanusCT6
Class: immune system
Keywords: Antibody engineering, immunoglobulin G1, Fc fragment, Fcab, heterodimeric Fcab, CH3 domain, VEGF, vascular endothelial growth factor, IMMUNE SYSTEM
Deposited on 2017-05-29, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (125)
      • engineered mutation (141)
      • engineered mutation (167)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d5o4ea1, d5o4ea2
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (125-126)
      • engineered mutation (134-136)
      • insertion (163-164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • engineered mutation (164)
      • engineered mutation (164)
      • engineered mutation (185)
      • engineered mutation (187)
      • engineered mutation (193-196)
      • engineered mutation (198-199)
      • engineered mutation (201-202)
      • engineered mutation (220)
      • engineered mutation (222-226)
      • insertion (170-172)
      • engineered mutation (173-174)
      • engineered mutation (190)
      • engineered mutation (192)
      • engineered mutation (198-201)
      • engineered mutation (203-204)
      • engineered mutation (206-207)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d5o4eb1, d5o4eb2
  • Chain 'C':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (125)
      • engineered mutation (141)
      • engineered mutation (167)
      • engineered mutation (169)
    Domains in SCOPe 2.07: d5o4ec1, d5o4ec2
  • Chain 'D':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5
      • engineered mutation (125-126)
      • engineered mutation (134-136)
      • insertion (163-164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • engineered mutation (164)
      • engineered mutation (164)
      • engineered mutation (180)
      • engineered mutation (182)
      • engineered mutation (188-191)
      • engineered mutation (193-194)
      • engineered mutation (196-197)
      • engineered mutation (215)
      • engineered mutation (217-222)
      • insertion (165-167)
      • engineered mutation (168-169)
      • engineered mutation (185)
      • engineered mutation (187)
      • engineered mutation (193-196)
      • engineered mutation (198-199)
      • engineered mutation (201-202)
      • engineered mutation (220)
      • engineered mutation (222-225)
    Domains in SCOPe 2.07: d5o4ed1, d5o4ed2
  • Chain 'E':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (0-End)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d5o4ee_
  • Chain 'F':
    Compound: Vascular Endothelial Growth Factor A
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGFA, VEGF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15692 (0-End)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d5o4ef_
  • Heterogens: NAG, BMA, MAN, FUC, MPD, MRD, CAC, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o4eA (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvyvlppsrdeltknqvsllclvkgfypsdiavewesngqpennyltwppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4eA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyvlppsr
    deltknqvsllclvkgfypsdiavewesngqpennyltwppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o4eB (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvyvyppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvld
    sdgsfalvskltvpypswlmgtrfscsvmhealhnhytqkhleyqwpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4eB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyvyppsr
    delrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvldsdgsfalvskl
    tvpypswlmgtrfscsvmhealhnhytqkhleyqwp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o4eC (C:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvyvlppsrdeltknqvsllclvkgfypsdiavewesngqpennyltwppvldsdgsf
    flyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4eC (C:)
    vflfppkpkdtlmisrtpevtcvvkfnwyvdgvevhnaktkpreevvsvltvlhqdwlng
    keykckvsiektiskakgqprepqvyvlppsrdeltknqvsllclvkgfypsdiavewes
    ngqpennyltwppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5o4eD (D:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvyvyppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvld
    sdgsfalvskltvpypswlmgtrfscsvmhealhnhytqkhleyqwpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4eD (D:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyvyppsrd
    elrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvldsdgsfalvsklt
    vpypswlmgtrfscsvmhealhnhytqkhleyqw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5o4eE (E:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4eE (E:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5o4eF (F:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4eF (F:)
    mvvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
    esnitmqimrikphqgqhigemsflqhnkcecrpk