PDB entry 5o4a

View 5o4a on RCSB PDB site
Description: Human FGF in complex with a covalent inhibitor
Class: transferase
Keywords: FGFR Fibroblast Growth Factor, covalent inhibition, FGFR Fibroblast Grwth Fctr RTK, transferase
Deposited on 2017-05-26, released 2018-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (31)
    Domains in SCOPe 2.07: d5o4aa_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • conflict (31)
      • conflict (127)
    Domains in SCOPe 2.07: d5o4ab_
  • Heterogens: SO4, GOL, 9K8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o4aA (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4aA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
    dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgeeq
    lsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyy
    kkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllk
    eghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o4aB (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o4aB (B:)
    vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdat
    ekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgl
    eysyeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglhid
    yykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkl
    lkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn