PDB entry 5o41

View 5o41 on RCSB PDB site
Description: Low-dose fixed target serial synchrotron crystallography structure of sperm whale myoglobin
Class: oxygen binding
Keywords: oxygen storage, OXYGEN BINDING
Deposited on 2017-05-25, released 2017-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • engineered mutation (122)
  Domains in SCOPe 2.08: d5o41a_
• Heterogens: HEM, SO4, CMO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5o41A (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg