PDB entry 5o3p

View 5o3p on RCSB PDB site
Description: Carbon regulatory PII-like protein SbtB from Synechocystis sp. 6803 in Apo state, trigonal crystal form
Class: signaling protein
Keywords: SbtB, Carbon sensing, PII-like, cyanobacteria, signaling protein
Deposited on 2017-05-24, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Membrane-associated protein slr1513
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: slr1513
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73954 (Start-109)
      • expression tag (110)
    Domains in SCOPe 2.07: d5o3pa1, d5o3pa2
  • Chain 'B':
    Compound: Membrane-associated protein slr1513
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: slr1513
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73954 (Start-109)
      • expression tag (110-113)
    Domains in SCOPe 2.07: d5o3pb1, d5o3pb2
  • Chain 'C':
    Compound: Membrane-associated protein slr1513
    Species: SYNECHOCYSTIS SP. PCC 6803 [TaxId:1148]
    Gene: slr1513
    Database cross-references and differences (RAF-indexed):
    • Uniprot P73954 (Start-109)
      • expression tag (110-113)
    Domains in SCOPe 2.07: d5o3pc1, d5o3pc2
  • Heterogens: 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o3pA (A:)
    makpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieani
    kfeiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegcsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o3pA (A:)
    akpanklvivtekillkkiakiidesgakgytvmntggkgdieanikfeiltetremaee
    iadrvavkyfndyagiiyicsaevlyghtfcgpegcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o3pB (B:)
    makpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieani
    kfeiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegcsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o3pB (B:)
    akpanklvivtekillkkiakiidesgakgytvmntggkgsdieanikfeiltetremae
    eiadrvavkyfndyagiiyicsaevlyghtfcgpegcsaws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5o3pC (C:)
    makpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieani
    kfeiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegcsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o3pC (C:)
    akpanklvivtekillkkiakiidesgakgytvmntggkgieanikfeiltetremaeei
    adrvavkyfndyagiiyicsaevlyghtfcgpegcsaws