PDB entry 5o2t

View 5o2t on RCSB PDB site
Description: Human KRAS in complex with darpin K27
Class: signaling protein
Keywords: KRAS, RAS signalling, darpin, nucleotide exchange, signaling protein
Deposited on 2017-05-22, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-End)
      • variant (14)
    Domains in SCOPe 2.06: d5o2ta_
  • Chain 'B':
    Compound: darpin 55
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5O2T
    Domains in SCOPe 2.06: d5o2tb1, d5o2tb2
  • Heterogens: MG, GSP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o2tA (A:)
    gshmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2tA (A:)
    mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o2tB (B:)
    mghhhhhhhhhhssghiegrhmdlgkklleaaragqddevrilmangadvnandsaghtp
    lhlaakrghleivevllkhgadvnamdntgftplhlaalrghleivevllkngadvnaqd
    rtgrtplhlaaklghleivevllkngadvnaqdkfgktafdisidngnedlaeilqklyp
    ydvpdya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o2tB (B:)
    grhmdlgkklleaaragqddevrilmangadvnandsaghtplhlaakrghleivevllk
    hgadvnamdntgftplhlaalrghleivevllkngadvnaqdrtgrtplhlaaklghlei
    vevllkngadvnaqdkfgktaf