PDB entry 5o1k

View 5o1k on RCSB PDB site
Description: crystal structure of murine neuroglobin mutant V140W under 20 bar xenon pressure
Class: transport protein
Keywords: globin, oxygen transporter, transport protein
Deposited on 2017-05-18, released 2017-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (0-147)
      • engineered mutation (52)
      • engineered mutation (117)
      • engineered mutation (137)
    Domains in SCOPe 2.06: d5o1ka_
  • Heterogens: HEM, SO4, XE, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5o1kA (A:)
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygawvqamsrgwdg