PDB entry 5o1f

View 5o1f on RCSB PDB site
Description: p53 cancer mutant Y220C in complex with compound MB582
Class: DNA binding protein
Keywords: p53, tumor suppressor, cancer mutation, protein stabilization, small-molecule stabilizers, cancer therapy, DNA binding protein, molecular chaperones
Deposited on 2017-05-18, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5o1fa_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (39)
      • engineered mutation (109)
      • engineered mutation (126)
      • engineered mutation (145)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d5o1fb_
  • Heterogens: ZN, 9GQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5o1fA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o1fA (A:)
    svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
    rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
    vvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
    acpgrdrrteeenlrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5o1fB (B:)
    sssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5o1fB (B:)
    ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppg
    trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrh
    svvvpceppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrv
    cacpgrdrrteeenlrk