PDB entry 5nyz

View 5nyz on RCSB PDB site
Description: Twist and induce: Dissecting the link between the enzymatic activity and the SaPI inducing capacity of the phage 80 dUTPase. D95E mutant from dUTPase 80alpha phage.
Class: hydrolase
Keywords: dUTPase, 80 phage, S.aureus, hydrolase
Deposited on 2017-05-12, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dutpase
    Species: STAPHYLOCOCCUS PHAGE 80ALPHA [TaxId:53369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4ZF98 (0-End)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d5nyza_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5nyzA (A:)
mtntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl
ltsrsgvsskthlvietgkidagyhgnlginikneheddkmqtiflrnidnekifekerh
lyklgsyriekgeriaqlvivpiwtpelkqveefesvsergekgfgssgv

    Sequence, based on observed residues (ATOM records): (download) 
    >5nyzA (A:)
mtntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl
ltsrsgvsskthlvietgkidagyhgnlginikneheddkmqtiflrnidnekifekerh
lyklgsyriekgeriaqlvivpiwtpelkqveefesvergekgfgss