PDB entry 5nxj

View 5nxj on RCSB PDB site
Description: SH3 domain from Mouse cortactin (P 1 21 1 crystal form)
Class: protein binding
Keywords: SH3 domain, cortactin, signaling, cancer, invadopodium, protein binding
Deposited on 2017-05-10, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5nxja1, d5nxja2
  • Chain 'B':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5nxjb1, d5nxjb2
  • Chain 'C':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5nxjc1, d5nxjc2
  • Chain 'D':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5nxjd1, d5nxjd2
  • Chain 'E':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5nxje1, d5nxje2
  • Chain 'F':
    Compound: Src substrate cortactin
    Species: Mus musculus [TaxId:10090]
    Gene: Cttn, Ems1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60598 (3-59)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5nxjf1, d5nxjf2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nxjA (A:)
ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nxjB (B:)
ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nxjC (C:)
ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nxjD (D:)
ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nxjE (E:)
ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nxjF (F:)
ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq