PDB entry 5nx5

View 5nx5 on RCSB PDB site
Description: Crystal structure of Linalool/Nerolidol synthase from Streptomyces clavuligerus in complex with 2-fluorogeranyl diphosphate
Class: ligase
Keywords: terpene synthase, linalool, nerolidol, monoterpenoid, ligase
Deposited on 2017-05-09, released 2017-09-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentalenene synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: SCLAV_p1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nx5a_
  • Chain 'B':
    Compound: pentalenene synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: SCLAV_p1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5nx5b_
  • Heterogens: MG, 0FV, CL, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nx5A (A:)
    mqefefavpapsrvspdlarararhldwvhamdlvrgeearrryefscvadigaygypha
    tgadldlcvdvlgwtflfddqfdagdgrerdalavcaeltdllwkgtaataasppivvaf
    sdcwermragmsdawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrp
    lfalaervggyevprrawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvh
    hggltgpeavtrvcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyh
    dwgrgasryttrdhpgdlglenlvarssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx5A (A:)
    rvspdlarararhldwvhamdlvrgeearrryefscvadigaygyphatgadldlcvdvl
    gwtflfddqfdrerdalavcaeltdllwkgtaataasppivvafsdcwermragmsdawr
    rrtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervggyevprr
    awhssrldgmrfttsdavigmnelhsfekdraqhanlvlslvhhggltgpeavtrvcdlv
    qgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nx5B (B:)
    mqefefavpapsrvspdlarararhldwvhamdlvrgeearrryefscvadigaygypha
    tgadldlcvdvlgwtflfddqfdagdgrerdalavcaeltdllwkgtaataasppivvaf
    sdcwermragmsdawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrp
    lfalaervggyevprrawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvh
    hggltgpeavtrvcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyh
    dwgrgasryttrdhpgdlglenlvarssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx5B (B:)
    fefavpapsrvspdlarararhldwvhamdlvryefscvadigaygyphatgadldlcvd
    vlgwtflfddqfdrerdalavcaeltdllwkgtataasppivvafsdcwermragmsdaw
    rrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervggyevpr
    rawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvhhgltgpeavtrvcdl
    vqgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgrgsry