PDB entry 5nx4

View 5nx4 on RCSB PDB site
Description: Crystal structure of Linalool/Nerolidol synthase from Streptomyces clavuligerus
Class: ligase
Keywords: terpene synthase, linalool, nerolidol, monoterpenoid, ligase
Deposited on 2017-05-09, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentalenene synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: SCLAV_p1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nx4a_
  • Chain 'B':
    Compound: pentalenene synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: SCLAV_p1185
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nx4b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nx4A (A:)
    mqefefavpapsrvspdlarararhldwvhamdlvrgeearrryefscvadigaygypha
    tgadldlcvdvlgwtflfddqfdagdgrerdalavcaeltdllwkgtaataasppivvaf
    sdcwermragmsdawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrp
    lfalaervggyevprrawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvh
    hggltgpeavtrvcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyh
    dwgrgasryttrdhpgdlglenlvarssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx4A (A:)
    efavppsrvspdlarararhldwvhamdlvrgeearrryefscvadigaygyphatgadl
    dlcvdvlgwtflfddqfderdalavcaeltdllwkgtaataasppivvafsdcwermrag
    msdawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervgg
    yevprrawhssrldgmrfttsdavigmnelhsfekdraqhanlvlslvhhggltgpeavt
    rvcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nx4B (B:)
    mqefefavpapsrvspdlarararhldwvhamdlvrgeearrryefscvadigaygypha
    tgadldlcvdvlgwtflfddqfdagdgrerdalavcaeltdllwkgtaataasppivvaf
    sdcwermragmsdawrrrtvhewvdylagwptkladrahgavldpaahlrarhrticcrp
    lfalaervggyevprrawhssrldgmrfttsdavigmnelhsfekdraqghanlvlslvh
    hggltgpeavtrvcdlvqgsiesflrlrsglpelgralgvegavldryadalsafcrgyh
    dwgrgasryttrdhpgdlglenlvarssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nx4B (B:)
    fefavpapsrvspdlarararhldwvhamdlvyefscvadigaygyphatgadldlcvdv
    lgwtflfddqfdrdalavcaeltdllwkgtaataasppivvafsdcwermragmsdawrr
    rtvhewvdylagwptkladrahgavldpaahlrarhrticcrplfalaervggyevprra
    whssrldgmrfttsdavigmnelhsfekdraqghanlvlslvhhggltgpeavtrvcdlv
    qgsiesflrlrsglpelgralgvegavldryadalsafcrgyhdwgr