PDB entry 5nw3

View 5nw3 on RCSB PDB site
Description: The cryofrozen atomic resolution X-ray crystal structure of perdeuterated Pyrococcus furiosus Rubredoxin (100K, 0.59A resolution)
Class: electron transport
Keywords: Perdeuterated rubredoxin, pyrococcus furiosus, atomic resolution, ELECTRON TRANSPORT
Deposited on 2017-05-04, released 2017-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 0.59 Å
R-factor: N/A
AEROSPACI score: 1.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5nw3a_
  • Heterogens: FE, NA, K, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nw3A (A:)
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled