PDB entry 5nvj

View 5nvj on RCSB PDB site
Description: SH3 domain from Mouse cortactin (C 1 2 1 crystal form)
Class: signaling protein
Keywords: SH3 domain, cortactin, signaling, cancer, invadopodium, signaling protein
Deposited on 2017-05-04, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Src substrate cortactin
  Species: Mus musculus [TaxId:10090]
  Gene: Cttn, Ems1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60598 (3-59)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d5nvja1, d5nvja2
• Chain 'B':
  Compound: Src substrate cortactin
  Species: Mus musculus [TaxId:10090]
  Gene: Cttn, Ems1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60598 (3-59)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d5nvjb1, d5nvjb2
• Heterogens: BAM, GOL, CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5nvjA (A:)
  ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5nvjB (B:)
  ghmgitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq