PDB entry 5nuz

View 5nuz on RCSB PDB site
Description: Junin virus GP1 glycoprotein in complex with an antibody Fab fragment
Class: immune system
Keywords: viral antigen-antibody complex, immune system
Deposited on 2017-05-03, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eOD01 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NUZ
  • Chain 'B':
    Compound: eOD01 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NUZ
    Domains in SCOPe 2.07: d5nuzb1, d5nuzb2
  • Chain 'C':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Junin mammarenavirus [TaxId:11619]
    Gene: GPC
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Junin mammarenavirus [TaxId:11619]
    Gene: GPC
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: eOD01 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NUZ
  • Chain 'L':
    Compound: eOD01 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NUZ
    Domains in SCOPe 2.07: d5nuzl1, d5nuzl2
  • Heterogens: GOL, IPA, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nuzB (B:)
    etgdivltqspaslavslgqratiscrasesvddygisfmnwfqqkpgqppklliytass
    qgsgvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleikradaap
    tvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdsty
    smsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nuzB (B:)
    gdivltqspaslavslgqratiscrasesvddygisfmnwfqqkpgqppklliytassqg
    sgvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5nuzL (L:)
    etgdivltqspaslavslgqratiscrasesvddygisfmnwfqqkpgqppklliytass
    qgsgvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleikradaap
    tvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdsty
    smsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nuzL (L:)
    tgdivltqspaslavslgqratiscrasesvddygisfmnwfqqkpgqppklliytassq
    gsgvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleikradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrne