PDB entry 5nuf

View 5nuf on RCSB PDB site
Description: Cytosolic Malate Dehydrogenase 1
Class: oxidoreductase
Keywords: Dehydrogenase, Malate/Oxaloacetate, NAD+, oxidoreductase
Deposited on 2017-04-29, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase 1, cytoplasmic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MDH1, At1g04410, F19P19.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nufa1, d5nufa2
  • Chain 'B':
    Compound: Malate dehydrogenase 1, cytoplasmic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MDH1, At1g04410, F19P19.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nufb1, d5nufb2
  • Chain 'C':
    Compound: Malate dehydrogenase 1, cytoplasmic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MDH1, At1g04410, F19P19.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nufc1, d5nufc2
  • Heterogens: NAD, SO4, GOL, PEO, PEG, NA, EDO, ACT, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nufA (A:)
    makepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelid
    aafpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekh
    aapnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvk
    nviiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikark
    lssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsiv
    qglpidevsrkkmdltaeelkeekdlayscls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nufA (A:)
    akepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelida
    afpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekha
    apnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvkn
    viiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikarkl
    ssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsivq
    glpidevsrkkmdltaeelkeekdlayscls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nufB (B:)
    makepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelid
    aafpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekh
    aapnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvk
    nviiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikark
    lssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsiv
    qglpidevsrkkmdltaeelkeekdlayscls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nufB (B:)
    epvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelidaaf
    pllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekhaap
    nckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvknvi
    iwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikarklss
    alsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsivqgl
    pidevsrkkmdltaeelkeekdlayscls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nufC (C:)
    makepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelid
    aafpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekh
    aapnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvk
    nviiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikark
    lssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsiv
    qglpidevsrkkmdltaeelkeekdlayscls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nufC (C:)
    akepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelida
    afpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekha
    apnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvkn
    viiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikarkl
    ssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsivq
    glpidevsrkkmdltaeelkeekdlayscls