PDB entry 5nue

View 5nue on RCSB PDB site
Description: Cytosolic Malate Dehydrogenase 1 (peroxide-treated)
Class: oxidoreductase
Keywords: Dehydrogenase, Oxidized, Malate/Oxaloacetate, NAD+, oxidoreductase
Deposited on 2017-04-29, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate dehydrogenase 1, cytoplasmic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MDH1, At1g04410, F19P19.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nuea1, d5nuea2
  • Chain 'B':
    Compound: Malate dehydrogenase 1, cytoplasmic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MDH1, At1g04410, F19P19.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nueb1, d5nueb2
  • Chain 'C':
    Compound: Malate dehydrogenase 1, cytoplasmic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: MDH1, At1g04410, F19P19.13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nuec1, d5nuec2
  • Heterogens: NAD, SO4, GOL, PEO, FMT, TRS, ETX, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nueA (A:)
    makepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelid
    aafpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekh
    aapnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvk
    nviiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikark
    lssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsiv
    qglpidevsrkkmdltaeelkeekdlayscls
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nueA (A:)
    akepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelida
    afpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekha
    apnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvkn
    viiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikarkl
    ssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsivq
    glpidevsrkkmdltaeelkeekdlayscls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nueB (B:)
    makepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelid
    aafpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekh
    aapnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvk
    nviiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikark
    lssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsiv
    qglpidevsrkkmdltaeelkeekdlayscls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nueC (C:)
    makepvrvlvtgaagqigyalvpmiargimlgadqpvilhmldippaaealngvkmelid
    aafpllkgvvattdavegctgvnvavmvggfprkegmerkdvmsknvsiyksqaaalekh
    aapnckvlvvanpantnalilkefapsipekniscltrldhnralgqiserlsvpvsdvk
    nviiwgnhsssqypdvnhakvqtssgekpvrelvkddawldgefistvqqrgaaiikark
    lssalsaassacdhirdwvlgtpegtfvsmgvysdgsysvpsgliysfpvtcrngdwsiv
    qglpidevsrkkmdltaeelkeekdlayscls