PDB entry 5nu1

View 5nu1 on RCSB PDB site
Description: Structural states of RORgt: X-ray elucidation of molecular mechanisms and binding interactions for natural and synthetic compounds
Class: signaling protein
Keywords: nuclear hormone receptor, ligand-binding domain, inverse agonist, signaling protein
Deposited on 2017-04-28, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5nu1a_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d5nu1b_
  • Chain 'P':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 8YB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nu1A (A:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nu1A (A:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nu1B (B:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nu1B (B:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.