PDB entry 5nt7

View 5nt7 on RCSB PDB site
Description: Structure of the LOTUS domain of Oskar in complex with the C-terminal RecA-like domain of Vasa
Class: hydrolase/hydrolase regulator
Keywords: DEAD-box RNA helicase, ATPase, RNA binding, regulator, stimulator, germ plasm, nuage, LOTUS, hydrolase- hydrolase regulator complex, hydrolase-hydrolase regulator complex
Deposited on 2017-04-27, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maternal effect protein oskar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: osk, CG10901
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP-dependent RNA helicase vasa, isoform A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: vas, vasa, CG46283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nt7b_
  • Chain 'C':
    Compound: maternal effect protein oskar
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: osk, CG10901
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP-dependent RNA helicase vasa, isoform A
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: vas, vasa, CG46283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nt7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nt7B (B:)
    ghsdvkqtiyevnkyakrsklieilseqadgtivfvetkrgadflasflsekefpttsih
    gdrlqsqreqalrdfkngsmkvliatsvasrgldiknikhvinydmpskiddyvhrigrt
    grvgnngratsffdpekdraiaadlvkilegsgqtvpdflrtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nt7B (B:)
    vkqtiyevnkyakrsklieilseqadgtivfvetkrgadflasflsekefpttsihgdrl
    qsqreqalrdfkngsmkvliatsvasrgldiknikhvinydmpskiddyvhrigrtgrat
    sffdpekdraiaadlvkilegsgqtvpdflrtc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nt7D (D:)
    ghsdvkqtiyevnkyakrsklieilseqadgtivfvetkrgadflasflsekefpttsih
    gdrlqsqreqalrdfkngsmkvliatsvasrgldiknikhvinydmpskiddyvhrigrt
    grvgnngratsffdpekdraiaadlvkilegsgqtvpdflrtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nt7D (D:)
    vkqtiyevnkyakrsklieilseqadgtivfvetkrgadflasflsekefpttsihgdrl
    qsqreqalrdfkngsmkvliatsvasrgldiknikhvinydmpskiddyvhrigrtgrat
    sffdpekdraiaadlvkilegsgqtvpdflrtc