PDB entry 5nt1

View 5nt1 on RCSB PDB site
Description: Complex of influenza A NS1 effector domain with TRIM25 coiled coil
Class: ligase
Keywords: Viral protein/host protein, ligase
Deposited on 2017-04-27, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e3 ubiquitin/isg15 ligase trim25
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM25, EFP, RNF147, ZNF147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14258 (3-End)
      • variant (171)
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) [TaxId:211044]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nt1b_
  • Chain 'E':
    Compound: e3 ubiquitin/isg15 ligase trim25
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM25, EFP, RNF147, ZNF147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14258 (3-End)
      • variant (171)
  • Chain 'F':
    Compound: Non-structural protein 1
    Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) [TaxId:211044]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nt1f_
  • Chain 'I':
    Compound: e3 ubiquitin/isg15 ligase trim25
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM25, EFP, RNF147, ZNF147
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14258 (3-End)
      • variant (171)
  • Chain 'J':
    Compound: Non-structural protein 1
    Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) [TaxId:211044]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nt1j_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nt1B (B:)
    gpgtmasvpasryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsv
    ifdrletlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvse
    tlqrfawrssnengrppltpkqkremagtirsev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nt1B (B:)
    asryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
    llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawrs
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nt1F (F:)
    gpgtmasvpasryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsv
    ifdrletlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvse
    tlqrfawrssnengrppltpkqkremagtirsev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nt1F (F:)
    asryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
    llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawrs
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5nt1J (J:)
    gpgtmasvpasryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsv
    ifdrletlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvse
    tlqrfawrssnengrppltpkqkremagtirsev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nt1J (J:)
    asryltdmtleemsrewsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
    llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawr