PDB entry 5nri

View 5nri on RCSB PDB site
Description: Crystal structure of Burkholderia pseudomallei D-alanine-D-alanine ligase in complex with AMP and D-Ala-D-Ala
Class: ligase
Keywords: Ligase, complex
Deposited on 2017-04-23, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia pseudomallei [TaxId:357348]
    Gene: ddl, BURPS1106A_3548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nria1, d5nria2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Burkholderia pseudomallei [TaxId:357348]
    Gene: ddl, BURPS1106A_3548
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nrib1, d5nrib2
  • Heterogens: AMP, DAL, MG, SO4, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nriA (A:)
    msgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkde
    gfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptpp
    fetvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaakhdki
    viveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcgldaakea
    efkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigys
    elvvkvlsltld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nriA (A:)
    sgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdeg
    fvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptppf
    etvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaakhdkiv
    iveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcgldaakeae
    fkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigyse
    lvvkvlsltld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nriB (B:)
    msgidpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkde
    gfvrafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptpp
    fetvmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaakhdki
    viveksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcgldaakea
    efkriarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigys
    elvvkvlsltld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nriB (B:)
    idpkrfgkvavllggdsaerevslnsgrlvlqglrdagidahpfdpaqrplaalkdegfv
    rafnalhggygengqiqgaldfygirytgsgvlgsalgldkfrtklvwqqtgiptppfet
    vmrgddyaaraqdivaklgvplfvkpasegssvavekvksadalpaaleeaakhdkiviv
    eksiegggeytaciaadldlplirivpagefydyhakyiandtqylipcgldaakeaefk
    riarrafdvlgctdwgradfmldaagnpyflevntapgmtdhslppkaaravgigyselv
    vkvlsltld