PDB entry 5nqh

View 5nqh on RCSB PDB site
Description: Structure of the human Fe65-PTB2 homodimer
Class: signaling protein
Keywords: Alzheimers disease, phosphotyrosine-binding (PTB) domain, signaling PROTEIN, homodimerization
Deposited on 2017-04-20, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65, RIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nqha_
  • Chain 'B':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65, RIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nqhb_
  • Chain 'C':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65, RIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nqhc_
  • Chain 'D':
    Compound: Amyloid beta A4 precursor protein-binding family B member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APBB1, FE65, RIR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nqhd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nqhA (A:)
    apknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltil
    hqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaa
    cmlryqkcldarsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqhA (A:)
    lvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqte
    avlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlry
    qkcldars
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nqhB (B:)
    apknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltil
    hqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaa
    cmlryqkcldarsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqhB (B:)
    lvqkfqvyylgnvpvakpvgvdvingalesvlssqwtpshvsvapatltilhqqteavlg
    ecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlryqkcl
    dar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nqhC (C:)
    apknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltil
    hqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaa
    cmlryqkcldarsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqhC (C:)
    lvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqqte
    avlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacmlry
    qkcld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nqhD (D:)
    apknelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltil
    hqqteavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaa
    cmlryqkcldarsqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nqhD (D:)
    lvqkfqvyylgnvpvakpvgvdvingalesvlssreqwtpshvsvapatltilhqqteav
    lgecrvrflsflavgrdvhtfafimaapasfcchmfwcepnaaslseavqaacmlryqkc
    ldars