PDB entry 5nqd

View 5nqd on RCSB PDB site
Description: Arsenite oxidase AioAB from Rhizobium sp. str. NT-26 mutant AioBF108A
Class: oxidoreductase
Keywords: Arsenite oxidase, DMSOR family, Rieske protein, oxidoreductase
Deposited on 2017-04-20, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aroa
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aroA, aioA, NT26_p10030
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Arsenite oxidase small subunit AioB Rieske [2Fe-2S] cluster
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aioB, NT26_p10029
    Database cross-references and differences (RAF-indexed):
    • Uniprot L0NMC5 (0-131)
      • conflict (64)
    Domains in SCOPe 2.08: d5nqdb_
  • Chain 'C':
    Compound: aroa
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aroA, aioA, NT26_p10030
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Arsenite oxidase small subunit AioB Rieske [2Fe-2S] cluster
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aioB, NT26_p10029
    Database cross-references and differences (RAF-indexed):
    • Uniprot L0NMC5 (0-131)
      • conflict (64)
    Domains in SCOPe 2.08: d5nqdd_
  • Chain 'E':
    Compound: aroa
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aroA, aioA, NT26_p10030
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Arsenite oxidase small subunit AioB Rieske [2Fe-2S] cluster
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aioB, NT26_p10029
    Database cross-references and differences (RAF-indexed):
    • Uniprot L0NMC5 (0-131)
      • conflict (64)
    Domains in SCOPe 2.08: d5nqdf_
  • Chain 'G':
    Compound: aroa
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aroA, aioA, NT26_p10030
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Arsenite oxidase small subunit AioB Rieske [2Fe-2S] cluster
    Species: Rhizobium sp. NT-26 [TaxId:1125847]
    Gene: aioB, NT26_p10029
    Database cross-references and differences (RAF-indexed):
    • Uniprot L0NMC5 (0-131)
      • conflict (64)
    Domains in SCOPe 2.08: d5nqdh_
  • Heterogens: MGD, O, 4MO, F3S, SO4, PGE, GOL, FES, EDO, PEG, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nqdB (B:)
aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
phkgaplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
deliygrlsnvl

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nqdD (D:)
aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
phkgaplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
deliygrlsnvl

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nqdF (F:)
aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
phkgaplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
deliygrlsnvl

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5nqdH (H:)
aagveypanrlaniseltlnepldvaypdedaagvllklgtrveggvgpdgdivgfstic
phkgaplsysadnktfncpghfsvfdpekggqqvwgqatqnlpqyvlrvadngdifaegv
deliygrlsnvl