PDB entry 5npo

View 5npo on RCSB PDB site
Description: Promiscuous Protein Self-Assembly as a Function of Protein Stability
Class: hydrolase
Keywords: TEM1 beta-lactamase Hetrodimer, Hydrolase
Deposited on 2017-04-18, released 2017-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (1-263)
      • conflict (59)
    Domains in SCOPe 2.06: d5npoa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D3INY1 (Start-263)
      • engineered mutation (17)
      • engineered mutation (27)
      • engineered mutation (33)
      • engineered mutation (95)
      • engineered mutation (159)
      • engineered mutation (176)
      • engineered mutation (238)
      • expression tag (264)
    Domains in SCOPe 2.06: d5npob1, d5npob2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5npoA (A:)
    mhpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsri
    dagqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttigg
    pkeltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasr
    qqlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviytt
    gsqatmdernrqiaeigaslikhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5npoA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5npoB (B:)
    ahpetlvkvkdakdqlgkrvgyieldlasgkilvsfrpeerfpmmstfkvllcgavlsrv
    dagqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttigg
    pkeltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasr
    qqlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviymt
    gsqatmdernrqiaeigaslikhwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5npoB (B:)
    krvgyieldlasgkilvsfrpeerfpmmstfkvllcgavlsrvdagqeqlgrrihysqnd
    lveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggpkeltaflhnmgdhvtr
    ldrwepelneerdtttpvamattlrklltgelltaasrqqlidwmealpagwfiadksrg
    iiaalgpdgkpsrivviymtgatmdernrqiaeigaslikhwa