PDB entry 5noz

View 5noz on RCSB PDB site
Description: Structure of cyclophilin A in complex with 3,4-diaminobenzohydrazide
Class: isomerase
Keywords: LIGAND COMPLEX, BETA BARREL, PROLYL CIS/TRANS ISOMERASE, CYTOSOLIC, isomerase
Deposited on 2017-04-13, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5noza_
  • Heterogens: L99, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nozA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle