PDB entry 5now

View 5now on RCSB PDB site
Description: Structure of cyclophilin A in complex with pyridine-3,4-diamine
Class: isomerase
Keywords: ligand complex, beta barrel, prolyl cis/trans isomerase, cytosolic, isomerase
Deposited on 2017-04-13, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nowa_
  • Heterogens: L89, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nowA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle