PDB entry 5now

View 5now on RCSB PDB site
Description: Structure of cyclophilin A in complex with pyridine-3,4-diamine
Class: isomerase
Keywords: ligand complex, beta barrel, prolyl cis/trans isomerase, cytosolic, isomerase
Deposited on 2017-04-13, released 2017-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase A
  Species: Homo sapiens [TaxId:9606]
  Gene: PPIA, CYPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62937 (0-164)
  Domains in SCOPe 2.08: d5nowa_
• Heterogens: L89, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5nowA (A:)
  mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
  mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
  wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle