PDB entry 5nml

View 5nml on RCSB PDB site
Description: Nb36 Ser85Cys with Hg bound
Class: immune system
Keywords: Ig domain llama single domain antibody nanobody Hg derivative, immune system
Deposited on 2017-04-06, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML (0-End)
    Domains in SCOPe 2.07: d5nmla1, d5nmla2
  • Chain 'B':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmlb1, d5nmlb2
  • Chain 'C':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmlc1, d5nmlc2
  • Chain 'D':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmld1, d5nmld2
  • Chain 'E':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmle1, d5nmle2
  • Chain 'F':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmlf1, d5nmlf2
  • Chain 'G':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmlg1, d5nmlg2
  • Chain 'H':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmlh1, d5nmlh2
  • Chain 'I':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
    Domains in SCOPe 2.07: d5nmli1, d5nmli2
  • Chain 'J':
    Compound: Nanobody Nb36 Ser85Cys
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NML
  • Heterogens: HG, EDO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nmlA (A:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlA (A:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nmlB (B:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlB (B:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nmlC (C:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlC (C:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nmlD (D:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlD (D:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nmlE (E:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlE (E:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nmlF (F:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlF (F:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5nmlG (G:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlG (G:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnclkpedtadyfcnllgawgqgtqvtvss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5nmlH (H:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlH (H:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5nmlI (I:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nmlI (I:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs
    

  • Chain 'J':
    No sequence available.