PDB entry 5nm0

View 5nm0 on RCSB PDB site
Description: Nb36 Ser85Cys with Hg, crystal form 1
Class: immune system
Keywords: Ig domain llama single domain antibody nanobody Hg derivative, immune system
Deposited on 2017-04-05, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nb36
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NM0
    Domains in SCOPe 2.07: d5nm0a1, d5nm0a2
  • Chain 'B':
    Compound: Nb36
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NM0
    Domains in SCOPe 2.07: d5nm0b1, d5nm0b2
  • Chain 'C':
    Compound: Nb36
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NM0
    Domains in SCOPe 2.07: d5nm0c1, d5nm0c2
  • Chain 'D':
    Compound: Nb36
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NM0
    Domains in SCOPe 2.07: d5nm0d1, d5nm0d2
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nm0A (A:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm0A (A:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nm0B (B:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm0B (B:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nm0C (C:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm0C (C:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnclkpedtadyfcnllgatvwgqgtqvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nm0D (D:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nm0D (D:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs