PDB entry 5nlw

View 5nlw on RCSB PDB site
Description: Structure of Nb36 crystal form 2
Class: immune system
Keywords: Ig domain llama single domain antibody nanobody, immune system
Deposited on 2017-04-05, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody Nb36
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NLW
    Domains in SCOPe 2.07: d5nlwa1, d5nlwa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nlwA (A:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnslkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nlwA (A:)
    vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
    svkgrftiskdnakktvylqmnslkpedtadyfcnllgattmsnavwgqgtqvtvss