PDB entry 5nlu

View 5nlu on RCSB PDB site
Description: Structure of Nb36 crystal form 1
Class: immune system
Keywords: Ig domain llama single domain antibody nanobody, immune system
Deposited on 2017-04-05, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single domain llama antibody Nb36
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5NLU
    Domains in SCOPe 2.07: d5nlua1, d5nlua2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nluA (A:)
    mqvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtny
    vdsvkgrftiskdnakktvylqmnslkpedtadyfcnllgattmsnavwgqgtqvtvssh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nluA (A:)
    qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
    dsvkgrftiskdnakktvylqmnslkpedtadyfcnllgattmsnavwgqgtqvtvss