PDB entry 5nlj

View 5nlj on RCSB PDB site
Description: Crystal structure of Zn3-E16V human ubiquitin (hUb) mutant adduct, from a solution 70 mM zinc acetate/20% v/v TFE/1.3 mM E16V hUb
Class: ligase
Keywords: E16V mutant, ligase, ubiquitination, proteasome degradation, SIGNALING PROTEIN
Deposited on 2017-04-04, released 2017-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.06: d5nlja_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.06: d5nljb_
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.06: d5nljc_
  • Heterogens: ACT, ZN, PEG, ETF, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nljA (A:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nljA (A:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nljB (B:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nljB (B:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nljC (C:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nljC (C:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlr