PDB entry 5nlf

View 5nlf on RCSB PDB site
Description: Crystal structure of Zn2.7-E16V human ubiquitin (hUb) mutant adduct, from a solution 100 mM zinc acetate/1.3 mM E16V hUb
Class: ligase
Keywords: E16V mutant, ligase, ubiquitination, proteasome degradation, IMMUNE SYSTEM
Deposited on 2017-04-04, released 2017-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5nlfa_
  • Chain 'B':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5nlfb_
  • Chain 'C':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5nlfc_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nlfA (A:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nlfA (A:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nlfB (B:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nlfB (B:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nlfC (C:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nlfC (C:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlr