PDB entry 5nl9

View 5nl9 on RCSB PDB site
Description: Crystal structure of a peroxide stress regulator from Leptospira interrogans
Class: DNA binding protein
Keywords: Leptospira, oxidative stress response, Fur family, asymmetric homodimer, DNA binding protein
Deposited on 2017-04-04, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator (FUR family)
    Species: Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) [TaxId:267671]
    Gene: LIC_12034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72QS5 (6-150)
      • expression tag (5)
    Domains in SCOPe 2.07: d5nl9a1, d5nl9a2
  • Chain 'B':
    Compound: Transcriptional regulator (FUR family)
    Species: Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) [TaxId:267671]
    Gene: LIC_12034
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72QS5 (6-150)
      • expression tag (5)
    Domains in SCOPe 2.07: d5nl9b1, d5nl9b2
  • Heterogens: ZN, K, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nl9A (A:)
    gshmasmkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnas
    ratifnnlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekv
    lselkqdfklktgsslencnlsitlkgkknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nl9A (A:)
    smkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnasratif
    nnlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekvlselk
    qdfklktgsslencnlsitlkgkknp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nl9B (B:)
    gshmasmkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnas
    ratifnnlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekv
    lselkqdfklktgsslencnlsitlkgkknp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nl9B (B:)
    smkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnasratif
    nnlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekvlselk
    qdfklktgsslencnlsitlkgkknp