PDB entry 5nl4

View 5nl4 on RCSB PDB site
Description: Crystal structure of Zn1.3-E16V human ubiquitin (hUb) mutant adduct, from a solution 35 mM zinc acetate/1.3 mM E16V hUb
Class: ligase
Keywords: E16V mutant, ligase, ubiquitination, proteasome degradation
Deposited on 2017-04-04, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5nl4a_
  • Chain 'B':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5nl4b_
  • Chain 'C':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5nl4c_
  • Heterogens: ZN, ACT, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nl4A (A:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nl4A (A:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nl4B (B:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nl4B (B:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nl4C (C:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nl4C (C:)
    mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlr