PDB entry 5nj4

View 5nj4 on RCSB PDB site
Description: From macrocrystals to microcrystals: a strategy for membrane protein serial crystallography
Class: membrane protein
Keywords: membrane photosynthetic wild-type XFEL, membrane protein
Deposited on 2017-03-28, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nj4c_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nj4h1, d5nj4h2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nj4l_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Blastochloris viridis [TaxId:1079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nj4m_
  • Heterogens: HEC, DGA, SO4, LDA, HTO, BCB, BPB, FE2, MQ7, NS5, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nj4C (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nj4C (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nj4H (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nj4L (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nj4M (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk