PDB entry 5nhx

View 5nhx on RCSB PDB site
Description: Periplasmic domain of Outer Membrane Protein A from Klebsiella pneumoniae
Class: membrane protein
Keywords: Outer membrane protein Klebsiella pneumoniae periplasmic domain, membrane protein
Deposited on 2017-03-22, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein a
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: OMPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhxa_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nhxA (A:)
    atkhftlksdvlfnfnkatlkpegqqaldqlytqlsnmdpkdgsavvlgytdrigseayn
    qqlsekraqsvvdylvakgipagkisargmgesnpvtgntcdnvkaraalidclapdrrv
    eievkg