PDB entry 5nhs

View 5nhs on RCSB PDB site
Description: The crystal structure of Xanthomonas albilineans N5, N10-methylenetetrahydrofolate dehydrogenase-cyclohydrolase (FolD)
Class: oxidoreductase
Keywords: oxidoreductase, bifunctional protein dehydrogenase cyclohydrolase
Deposited on 2017-03-22, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: Xanthomonas albilineans GPE PC73 [TaxId:380358]
    Gene: folD, XALc_1581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhsa1, d5nhsa2
  • Chain 'B':
    Compound: Bifunctional protein folD
    Species: Xanthomonas albilineans GPE PC73 [TaxId:380358]
    Gene: folD, XALc_1581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nhsb1, d5nhsb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nhsA (A:)
    mtdsapvspvparildgrriaedlldelktrvdarlaagqprpglavvlvggdpastvyv
    rnkrraaekvgieafdydlpagtgeaellslidqlnadpkihgilvqlplpgiadasrli
    hridprkdvdgfhpqnvghlalrefglrpctprgivtllahtdqpvrgrnativgvsnhv
    grpmalelliagctvscchkftpadvlqthvrdadilvvavgrpglipgdwvkpgavvid
    vginrlddgrlvgdvgfeaaaqraswitpvpggvgpmtvatlmqntieaadaalrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhsA (A:)
    vparildgrriaedlldelktrvdarlaagqprpglavvlvggdpastvyvrnkrraaek
    vgieafdydlpagtgeaellslidqlnadpkihgilvqlplpgiadasrlihridprkdv
    dgghlalrefglrpctprgivtllahtdqpvrgrnativgvsnhvgrpmalelliagctv
    scchkftpadvlqthvrdadilvvavgrpglipgdwvkpgavvidvginrlddgrlvgdv
    gfeaaaqraswitpvpggvgpmtvatlmqntieaadaalrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nhsB (B:)
    mtdsapvspvparildgrriaedlldelktrvdarlaagqprpglavvlvggdpastvyv
    rnkrraaekvgieafdydlpagtgeaellslidqlnadpkihgilvqlplpgiadasrli
    hridprkdvdgfhpqnvghlalrefglrpctprgivtllahtdqpvrgrnativgvsnhv
    grpmalelliagctvscchkftpadvlqthvrdadilvvavgrpglipgdwvkpgavvid
    vginrlddgrlvgdvgfeaaaqraswitpvpggvgpmtvatlmqntieaadaalrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhsB (B:)
    vparildgrriaedlldelktrvdarlaagqprpglavvlvggdpastvyvrnkrraaek
    vgieafdydlpagtgeaellslidqlnadpkihgilvqlplpgiadasrlihridprkdv
    dgghlalrefglrpctprgivtllahtdqpvrgrnativgvsnhvgrpmalelliagctv
    scchkftpadvlqthvrdadilvvavgrpglipgdwvkpgavvidvginrlddgrlvgdv
    gfeaaaqraswitpvpggvgpmtvatlmqntieaadaalr