PDB entry 5nhn

View 5nhn on RCSB PDB site
Description: Super-Folder Green Fluorescent Protein Artificiall dimer linked via 148 position
Class: fluorescent protein
Keywords: Fluorescence, Dimer, click-chemistry, artificial dimer, fluorescent protein
Deposited on 2017-03-22, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (1-End)
      • expression tag (0)
      • engineered mutation (28)
      • chromophore (64)
      • engineered mutation (70)
      • engineered mutation (78)
      • engineered mutation (146)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d5nhna1, d5nhna2
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A059PIQ0 (1-229)
      • expression tag (0)
      • engineered mutation (28)
      • chromophore (64)
      • engineered mutation (70)
      • engineered mutation (78)
      • engineered mutation (146)
      • engineered mutation (204)
    Domains in SCOPe 2.07: d5nhnb1, d5nhnb2
  • Heterogens: DB5, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nhnA (A:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
    rielkgidfkedgnilghkleynfnsfnvyitadkqkngikanfkirhnvedgsvqladh
    yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nhnA (A:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
    rielkgidfkedgnilghkleynfnsfnvyitadkqkngikanfkirhnvedgsvqladh
    yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5nhnB (B:)
    skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
    ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
    rielkgidfkedgnilghkleynfnsknvyitadkqkngikanfkirhnvedgsvqladh
    yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagith