PDB entry 5ngv

View 5ngv on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE Activin receptor type-2B LIGAND BINDING DOMAIN IN COMPLEX WITH BIMAGRUMAB FV, ORTHORHOMBIC CRYSTAL FORM
Class: transferase
Keywords: three-finger toxin fold, antibody Fv fragment, transferase
Deposited on 2017-03-20, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-2B
    Species: Homo sapiens [TaxId:9606]
    Gene: Acvr2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ngva_
  • Chain 'H':
    Compound: anti-human ActRIIB mAb BYM338 heavy-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NGV (0-End)
    Domains in SCOPe 2.07: d5ngvh1, d5ngvh2
  • Chain 'L':
    Compound: anti-human ActRIIB mAb BYM338 light-chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5NGV (0-End)
    Domains in SCOPe 2.07: d5ngvl1, d5ngvl2
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ngvA (A:)
    gpkamaetreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcw
    lddfncydrqecvateenpqvyfcccegnfcnerfthlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ngvA (A:)
    etreciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfnc
    ydrqecvateenpqvyfcccegnfcnerfthlp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ngvH (H:)
    evqlvqsgaevkkpgasvkvsckasgytftssyinwvrqapgqglewmgtinpvsgstsy
    aqkfqgrvtmtrdtsistaymelsrlrsddtavyycarggwfdywgqgtlvtvsshhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ngvH (H:)
    evqlvqsgaevkkpgasvkvsckasgytftssyinwvrqapgqglewmgtinpvsgstsy
    aqkfqgrvtmtrdtsistaymelsrlrsddtavyycarggwfdywgqgtlvtvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ngvL (L:)
    esaltqpasvsgspgqsitisctgtssdvgsynyvnwyqqhpgkapklmiygvskrpsgv
    snrfsgsksgntasltisglqaedeadyycgtfaggsyygvfgggtkltvlwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ngvL (L:)
    esaltqpasvsgspgqsitisctgtssdvgsynyvnwyqqhpgkapklmiygvskrpsgv
    snrfsgsksgntasltisglqaedeadyycgtfaggsyygvfgggtkltvlw