PDB entry 5nfr

View 5nfr on RCSB PDB site
Description: Crystal structure of malate dehydrogenase from Plasmodium falciparum (PfMDH)
Class: oxidoreductase
Keywords: Malate metabolism, Dehydrogenase, Plasmodium falciparum, Oligomerisation, oxidoreductase
Deposited on 2017-03-15, released 2018-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfra1, d5nfra2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrb1, d5nfrb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrc1, d5nfrc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrd1, d5nfrd2
  • Chain 'E':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfre1, d5nfre2
  • Chain 'F':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrf1, d5nfrf2
  • Chain 'G':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrg1, d5nfrg2
  • Chain 'H':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrh1, d5nfrh2
  • Chain 'I':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfri1, d5nfri2
  • Chain 'J':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrj1, d5nfrj2
  • Chain 'K':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrk1, d5nfrk2
  • Chain 'L':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrl1, d5nfrl2
  • Chain 'M':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrm1, d5nfrm2
  • Chain 'N':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrn1, d5nfrn2
  • Chain 'O':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfro1, d5nfro2
  • Chain 'P':
    Compound: malate dehydrogenase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PF3D7_0618500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nfrp1, d5nfrp2
  • Heterogens: CIT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nfrA (A:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrA (A:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nfrB (B:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrB (B:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nfrC (C:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrC (C:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5nfrD (D:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrD (D:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5nfrE (E:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrE (E:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5nfrF (F:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrF (F:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5nfrG (G:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrG (G:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrtredligvngkimksvaesvklhcskafvicvsnpldim
    vnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvplqry
    tsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmiksyl
    ynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesiasvqsn
    tqkafdlik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5nfrH (H:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrH (H:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5nfrI (I:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrI (I:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5nfrJ (J:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrJ (J:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5nfrK (K:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrK (K:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5nfrL (L:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrL (L:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5nfrM (M:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrM (M:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5nfrN (N:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrN (N:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5nfrO (O:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrO (O:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5nfrP (P:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlikghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nfrP (P:)
    mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg
    tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp
    ldimvnvfhkfsnlphekicgmagildtsrycsliadklkvsaedvnavilgghgdlmvp
    lqrytsvngvplsefvkknmisqneiqeiiqktrnmgaeiiklakasaafapaaaitkmi
    ksylynennlftcavylnghyncsnlfvgstakinnkgahpvefpltkeeqdlytesias
    vqsntqkafdlik