PDB entry 5ndc

View 5ndc on RCSB PDB site
Description: Structure of ba3-type cytochrome c oxidase from Thermus thermophilus by serial femtosecond crystallography
Class: oxidoreductase
Keywords: Cytochrome c oxidase, Oxidoreductase, SFX, Respiratory chain enzyme
Deposited on 2017-03-08, released 2017-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ndca_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:274]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ndcb1, d5ndcb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide IIA
    Species: Thermus thermophilus [TaxId:274]
    Gene: HGMM_F04D06C07, TTMY_0198
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ndcc_
  • Heterogens: CU, HEM, HAS, OLC, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ndcA (A:)
    mhhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdayp
    llkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwma
    figlvvaalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaa
    npgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtgh
    pivyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidpt
    wkmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgl
    lgfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpi
    sdaqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvla
    givllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfav
    aailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ndcA (A:)
    srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
    ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllane
    atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
    fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiy
    tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
    slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
    ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
    flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
    fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
    lfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ndcB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ndcB (B:)
    vdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqe
    gpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegt
    ninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ndcC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ndcC (C:)
    kpkgalavilvltltilvfwlgvyavffarg