PDB entry 5nd5

View 5nd5 on RCSB PDB site
Description: Crystal structure of transketolase from Chlamydomonas reinhardtii in complex with TPP and Mg2+
Class: transferase
Keywords: TRANSFERASE, Calvin-Benson cycle, thiamine pyrophosphate, Magnesium-dependent activation
Deposited on 2017-03-07, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: TRK1, CHLREDRAFT_141319
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nd5a1, d5nd5a2, d5nd5a3
  • Chain 'B':
    Compound: transketolase
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: TRK1, CHLREDRAFT_141319
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5nd5b1, d5nd5b2, d5nd5b3
  • Heterogens: MG, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nd5A (A:)
    mhhhhhhhmaqaapaaakaaapsisrdevekcinairflaidainksksghpgmpmgcap
    mgyvlwnevmkynpknpdffnrdrfvlsaghgsmfqysmmhltgydsvpldqikqfrqwn
    sltpghpenfvtpgvevttgplgqgicnavglavaeahlaarfnkpdvkpivdhytycil
    gdgcmmegisneacslaghwglgklialyddnkisidghtdisftedvakryealgwhvi
    hvingntdvdglraaiaqakavkdkptlikvstligygspnkadshdvhgaplgpdetaa
    trknlnwpygefevpqdvydvfrgaikrgaeeeanwhkacaeykakypkewaefealtsc
    klpenweaalphfkpedkglatrqhsqtminalapalpgliggsadlapsnltlmkisgd
    fqkgsyaernlrfgvrehamgaicngialhksglipycatfyiftdymrnamrmsalsea
    gvvyvmthdsiglgedgpthqpiehlasframpdmlmirpaggnetagaykvaianrkrp
    ttialsrqnmpnipncsvegvakgaytihdtkagvkpdvilmgtgselelataaagilek
    egknvrvvsfpcwelfeeqsaeykesvlpsdvtarvsveaatsfgwakyiglkgkhvgid
    tfgasapaptlyekfgitvnhvveaakatlqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nd5A (A:)
    sisrdevekcinairflaidainksksghpgmpmgcapmgyvlwnevmkynpknpdffnr
    drfvlsaghgsmfqysmmhltgydsvpldqikqfrqwnsltpghpenfvtpgvevttgpl
    gqgicnavglavaeahlaarfnkpdvkpivdhytycilgdgcmmegisneacslaghwgl
    gklialyddnkisidghtdisftedvakryealgwhvihvingntdvdglraaiaqakav
    kdkptlikvstligygspnkadshdvhgaplgpdetaatrknlnwpygefevpqdvydvf
    rgaikrgaeeeanwhkacaeykakypkewaefealtscklpenweaalphfkpedkglat
    rqhsqtminalapalpgliggsadlapsnltlmkisgdfqkgsyaernlrfgvrehamga
    icngialhksglipycatfyiftdymrnamrmsalseagvvyvmthdsiglgedgpthqp
    iehlasframpdmlmirpaggnetagaykvaianrkrpttialsrqnmpnipncsvegva
    kgaytihdtkagvkpdvilmgtgselelataaagilekegknvrvvsfpcwelfeeqsae
    ykesvlpsdvtarvsveaatsfgwakyiglkgkhvgidtfgasapaptlyekfgitvnhv
    veaakatlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5nd5B (B:)
    mhhhhhhhmaqaapaaakaaapsisrdevekcinairflaidainksksghpgmpmgcap
    mgyvlwnevmkynpknpdffnrdrfvlsaghgsmfqysmmhltgydsvpldqikqfrqwn
    sltpghpenfvtpgvevttgplgqgicnavglavaeahlaarfnkpdvkpivdhytycil
    gdgcmmegisneacslaghwglgklialyddnkisidghtdisftedvakryealgwhvi
    hvingntdvdglraaiaqakavkdkptlikvstligygspnkadshdvhgaplgpdetaa
    trknlnwpygefevpqdvydvfrgaikrgaeeeanwhkacaeykakypkewaefealtsc
    klpenweaalphfkpedkglatrqhsqtminalapalpgliggsadlapsnltlmkisgd
    fqkgsyaernlrfgvrehamgaicngialhksglipycatfyiftdymrnamrmsalsea
    gvvyvmthdsiglgedgpthqpiehlasframpdmlmirpaggnetagaykvaianrkrp
    ttialsrqnmpnipncsvegvakgaytihdtkagvkpdvilmgtgselelataaagilek
    egknvrvvsfpcwelfeeqsaeykesvlpsdvtarvsveaatsfgwakyiglkgkhvgid
    tfgasapaptlyekfgitvnhvveaakatlqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nd5B (B:)
    sisrdevekcinairflaidainksksghpgmpmgcapmgyvlwnevmkynpknpdffnr
    drfvlsaghgsmfqysmmhltgydsvpldqikqfrqwnsltpghpenfvtpgvevttgpl
    gqgicnavglavaeahlaarfnkpdvkpivdhytycilgdgcmmegisneacslaghwgl
    gklialyddnkisidghtdisftedvakryealgwhvihvingntdvdglraaiaqakav
    kdkptlikvstligygspnkadshdvhgaplgpdetaatrknlnwpygefevpqdvydvf
    rgaikrgaeeeanwhkacaeykakypkewaefealtscklpenweaalphfkpedkglat
    rqhsqtminalapalpgliggsadlapsnltlmkisgdfqkgsyaernlrfgvrehamga
    icngialhksglipycatfyiftdymrnamrmsalseagvvyvmthdsiglgedgpthqp
    iehlasframpdmlmirpaggnetagaykvaianrkrpttialsrqnmpnipncsvegva
    kgaytihdtkagvkpdvilmgtgselelataaagilekegknvrvvsfpcwelfeeqsae
    ykesvlpsdvtarvsveaatsfgwakyiglkgkhvgidtfgasapaptlyekfgitvnhv
    veaakatlq