PDB entry 5nbk

View 5nbk on RCSB PDB site
Description: NDM-1 metallo-beta-lactamase: a parsimonious interpretation of the diffraction data
Class: hydrolase
Keywords: HYDROLASE, NDM-1, metallo-beta-lactamase
Deposited on 2017-03-02, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (Start-242)
      • expression tag (243-244)
    Domains in SCOPe 2.07: d5nbka1, d5nbka2
  • Chain 'C':
    Compound: Metallo-beta-lactamase type 2
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaNDM-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (Start-242)
      • expression tag (243-244)
    Domains in SCOPe 2.07: d5nbkc1, d5nbkc2
  • Heterogens: ZN, PG4, CL, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5nbkA (A:)
    mgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
    vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
    lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
    clikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmad
    klrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbkA (A:)
    rptigqqmetgdqrfgdlvfrqlapnvwqhtsyldgavasnglivrdggrvlvvdtawtd
    dqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmv
    aaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdska
    kslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklrle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5nbkC (C:)
    mgeirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvl
    vvdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnq
    lapqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafgg
    clikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmad
    klrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5nbkC (C:)
    dqrfgdlvfrqlapnvwqhtsyldgavasnglivrdggrvlvvdtawtddqtaqilnwik
    qeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsltfaan
    gwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlgdadt
    ehyaasarafgaafpkasmivmshsapdsraaithtarmadklrle